Anti C12orf71 pAb (ATL-HPA058728)

Atlas Antibodies

SKU:
ATL-HPA058728-25
  • Immunohistochemical staining of human small intestine shows distinct positivity in a subset of leukocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 12 open reading frame 71
Gene Name: C12orf71
Alternative Gene Name: LOC728858
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040163: 48%, ENSRNOG00000026864: 57%
Entrez Gene ID: 728858
Uniprot ID: A8MTZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDDSSKSNSNLSLSVGYFPCEDTPCEDTTSWEDAPSKGPSIHFLPPVQGAWGTERIGRRMKRQDQIQDEPEQFCKLSIFLAWDVDIGSDNTDSR
Gene Sequence EDDSSKSNSNLSLSVGYFPCEDTPCEDTTSWEDAPSKGPSIHFLPPVQGAWGTERIGRRMKRQDQIQDEPEQFCKLSIFLAWDVDIGSDNTDSR
Gene ID - Mouse ENSMUSG00000040163
Gene ID - Rat ENSRNOG00000026864
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C12orf71 pAb (ATL-HPA058728)
Datasheet Anti C12orf71 pAb (ATL-HPA058728) Datasheet (External Link)
Vendor Page Anti C12orf71 pAb (ATL-HPA058728) at Atlas Antibodies

Documents & Links for Anti C12orf71 pAb (ATL-HPA058728)
Datasheet Anti C12orf71 pAb (ATL-HPA058728) Datasheet (External Link)
Vendor Page Anti C12orf71 pAb (ATL-HPA058728)