Anti C12orf43 pAb (ATL-HPA046148 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046148-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and C12orf43 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411468).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 12 open reading frame 43
Gene Name: C12orf43
Alternative Gene Name: FLJ12448
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029559: 69%, ENSRNOG00000001185: 58%
Entrez Gene ID: 64897
Uniprot ID: Q96C57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHEQDGNELQTTPEFRAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGGREKEESPQPR
Gene Sequence AWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHEQDGNELQTTPEFRAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGGREKEESPQPR
Gene ID - Mouse ENSMUSG00000029559
Gene ID - Rat ENSRNOG00000001185
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C12orf43 pAb (ATL-HPA046148 w/enhanced validation)
Datasheet Anti C12orf43 pAb (ATL-HPA046148 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C12orf43 pAb (ATL-HPA046148 w/enhanced validation)