Anti C11orf74 pAb (ATL-HPA044880)

Atlas Antibodies

SKU:
ATL-HPA044880-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol & aggresome.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 74
Gene Name: C11orf74
Alternative Gene Name: FLJ38678, HEPIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027165: 72%, ENSRNOG00000037567: 57%
Entrez Gene ID: 119710
Uniprot ID: Q86VG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSE
Gene Sequence MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSE
Gene ID - Mouse ENSMUSG00000027165
Gene ID - Rat ENSRNOG00000037567
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C11orf74 pAb (ATL-HPA044880)
Datasheet Anti C11orf74 pAb (ATL-HPA044880) Datasheet (External Link)
Vendor Page Anti C11orf74 pAb (ATL-HPA044880) at Atlas Antibodies

Documents & Links for Anti C11orf74 pAb (ATL-HPA044880)
Datasheet Anti C11orf74 pAb (ATL-HPA044880) Datasheet (External Link)
Vendor Page Anti C11orf74 pAb (ATL-HPA044880)