Anti C11orf63 pAb (ATL-HPA077748)

Atlas Antibodies

SKU: ATL-HPA077748-25

• 

Protein Description: chromosome 11 open reading frame 63
Gene Name: C11orf63
Alternative Gene Name: FLJ23554
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032023: 87%, ENSRNOG00000008138: 85%
Entrez Gene ID: 79864
Uniprot ID: Q6NUN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELSDSDLEEKSSSLSPYVKSSSSHNEVFLPGSRGPRRRKSKQHFVEKNKLTLGLPTPKTDSYLQLHNKKRGESHPEQ
• Gene Sequence: ELSDSDLEEKSSSLSPYVKSSSSHNEVFLPGSRGPRRRKSKQHFVEKNKLTLGLPTPKTDSYLQLHNKKRGESHPEQ
• Gene ID - Mouse: ENSMUSG00000032023
• Gene ID - Rat: ENSRNOG00000008138
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.