Anti C11orf1 pAb (ATL-HPA057519)

Atlas Antibodies

SKU:
ATL-HPA057519-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 11 open reading frame 1
Gene Name: C11orf1
Alternative Gene Name: FLJ23499
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037971: 76%, ENSRNOG00000030962: 68%
Entrez Gene ID: 64776
Uniprot ID: Q9H5F2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAASQCLCCSKFLFQRQNLACFLTNPHCGSLVNADGHGEVWTDWNNMSKFFQYGWRCTTNENTYSNRTLMGNWNQ
Gene Sequence MAASQCLCCSKFLFQRQNLACFLTNPHCGSLVNADGHGEVWTDWNNMSKFFQYGWRCTTNENTYSNRTLMGNWNQ
Gene ID - Mouse ENSMUSG00000037971
Gene ID - Rat ENSRNOG00000030962
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C11orf1 pAb (ATL-HPA057519)
Datasheet Anti C11orf1 pAb (ATL-HPA057519) Datasheet (External Link)
Vendor Page Anti C11orf1 pAb (ATL-HPA057519) at Atlas Antibodies

Documents & Links for Anti C11orf1 pAb (ATL-HPA057519)
Datasheet Anti C11orf1 pAb (ATL-HPA057519) Datasheet (External Link)
Vendor Page Anti C11orf1 pAb (ATL-HPA057519)