Anti C10orf76 pAb (ATL-HPA050913)

Atlas Antibodies

SKU:
ATL-HPA050913-25
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic and membranous positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 10 open reading frame 76
Gene Name: C10orf76
Alternative Gene Name: FLJ13114
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039901: 100%, ENSRNOG00000025523: 100%
Entrez Gene ID: 79591
Uniprot ID: Q5T2E6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEGKLESLDGEELMKIKDNINCLFQHCIQALGEEHPIRVVNALQTLCALIRGVHQKNKSTSGFDIINMLMGFDKAELCMKNLM
Gene Sequence LEGKLESLDGEELMKIKDNINCLFQHCIQALGEEHPIRVVNALQTLCALIRGVHQKNKSTSGFDIINMLMGFDKAELCMKNLM
Gene ID - Mouse ENSMUSG00000039901
Gene ID - Rat ENSRNOG00000025523
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C10orf76 pAb (ATL-HPA050913)
Datasheet Anti C10orf76 pAb (ATL-HPA050913) Datasheet (External Link)
Vendor Page Anti C10orf76 pAb (ATL-HPA050913) at Atlas Antibodies

Documents & Links for Anti C10orf76 pAb (ATL-HPA050913)
Datasheet Anti C10orf76 pAb (ATL-HPA050913) Datasheet (External Link)
Vendor Page Anti C10orf76 pAb (ATL-HPA050913)