Anti C10orf55 pAb (ATL-HPA045739 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045739-25

• 
• 
• 

Protein Description: chromosome 10 open reading frame 55
Gene Name: C10orf55
Alternative Gene Name: bA417O11.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029636: 36%, ENSRNOG00000018561: 31%
Entrez Gene ID: 414236
Uniprot ID: Q5SWW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPTPVVLKPPLPPCPISWGESGPAVDGI
• Gene Sequence: PSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPTPVVLKPPLPPCPISWGESGPAVDGI
• Gene ID - Mouse: ENSMUSG00000029636
• Gene ID - Rat: ENSRNOG00000018561
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.