Anti C10orf128 pAb (ATL-HPA058166)

Atlas Antibodies

SKU: ATL-HPA058166-25

• 

Protein Description: chromosome 10 open reading frame 128
Gene Name: C10orf128
Alternative Gene Name: Em:AC084727.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041707: 60%, ENSRNOG00000042628: 52%
Entrez Gene ID: 170371
Uniprot ID: Q5T292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KICMIRRHLFDDDSSDLKSTPGGLSDTIPLKKRAPRAHVLRD
• Gene Sequence: KICMIRRHLFDDDSSDLKSTPGGLSDTIPLKKRAPRAHVLRD
• Gene ID - Mouse: ENSMUSG00000041707
• Gene ID - Rat: ENSRNOG00000042628
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.