Anti C10orf11 pAb (ATL-HPA050419 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050419-25

• 
• 

Protein Description: chromosome 10 open reading frame 11
Gene Name: C10orf11
Alternative Gene Name: CDA017, OCA7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063458: 92%, ENSRNOG00000011932: 33%
Entrez Gene ID: 83938
Uniprot ID: Q9H2I8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYK
• Gene Sequence: ELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYK
• Gene ID - Mouse: ENSMUSG00000063458
• Gene ID - Rat: ENSRNOG00000011932
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C10orf11 pAb (ATL-HPA050419 w/enhanced validation) – 1 Found

Beyers, Wyatt C; Detry, Anna M; Di Pietro, Santiago M. OCA7 is a melanosome membrane protein that defines pigmentation by regulating early stages of melanosome biogenesis. The Journal Of Biological Chemistry. 2022;298(12):102669.