Anti C10orf11 pAb (ATL-HPA047446)

Atlas Antibodies

SKU: ATL-HPA047446-25

• 
• 
• 

Protein Description: chromosome 10 open reading frame 11
Gene Name: C10orf11
Alternative Gene Name: CDA017, OCA7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063458: 81%, ENSRNOG00000039582: 25%
Entrez Gene ID: 83938
Uniprot ID: Q9H2I8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLPNLKFLDAQKVTRQEREEALVRGVFMKVVKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQ
• Gene Sequence: KLPNLKFLDAQKVTRQEREEALVRGVFMKVVKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQ
• Gene ID - Mouse: ENSMUSG00000063458
• Gene ID - Rat: ENSRNOG00000039582
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.