Anti BTBD7 pAb (ATL-HPA049926 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049926-25

• 
• 

Protein Description: BTB (POZ) domain containing 7
Gene Name: BTBD7
Alternative Gene Name: FLJ10648, FUP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041702: 98%, ENSRNOG00000008598: 99%
Entrez Gene ID: 55727
Uniprot ID: Q9P203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLHYLYTGEFGMEDSRFQNVDILVQLSEEFGTPNSLDVDMRGLFDYMCYYDVVLSFSSDSELVEAFGGNQNCLDEELKAHKAVISARSPFFRNLLQRRIRTGEE
• Gene Sequence: LLHYLYTGEFGMEDSRFQNVDILVQLSEEFGTPNSLDVDMRGLFDYMCYYDVVLSFSSDSELVEAFGGNQNCLDEELKAHKAVISARSPFFRNLLQRRIRTGEE
• Gene ID - Mouse: ENSMUSG00000041702
• Gene ID - Rat: ENSRNOG00000008598
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.