Anti BST1 pAb (ATL-HPA050121)

Atlas Antibodies

SKU: ATL-HPA050121-25

• 

Protein Description: bone marrow stromal cell antigen 1
Gene Name: BST1
Alternative Gene Name: CD157
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029082: 82%, ENSRNOG00000003064: 85%
Entrez Gene ID: 683
Uniprot ID: Q10588
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWE
• Gene Sequence: EGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWE
• Gene ID - Mouse: ENSMUSG00000029082
• Gene ID - Rat: ENSRNOG00000003064
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.