Anti BSPH1 pAb (ATL-HPA048335 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048335-25

• 

Protein Description: binder of sperm protein homolog 1
Gene Name: BSPH1
Alternative Gene Name: BSP1, ELSPBP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074378: 42%, ENSRNOG00000052287: 43%
Entrez Gene ID: 100131137
Uniprot ID: Q075Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCSLNKTY
• Gene Sequence: SACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCSLNKTY
• Gene ID - Mouse: ENSMUSG00000074378
• Gene ID - Rat: ENSRNOG00000052287
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.