Anti BRMS1L pAb (ATL-HPA046623)

Atlas Antibodies

SKU:
ATL-HPA046623-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: breast cancer metastasis-suppressor 1-like
Gene Name: BRMS1L
Alternative Gene Name: BRMS1, FLJ39177, MGC11296
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012076: 99%, ENSRNOG00000051077: 100%
Entrez Gene ID: 84312
Uniprot ID: Q5PSV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSK
Gene Sequence EDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSK
Gene ID - Mouse ENSMUSG00000012076
Gene ID - Rat ENSRNOG00000051077
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BRMS1L pAb (ATL-HPA046623)
Datasheet Anti BRMS1L pAb (ATL-HPA046623) Datasheet (External Link)
Vendor Page Anti BRMS1L pAb (ATL-HPA046623) at Atlas Antibodies

Documents & Links for Anti BRMS1L pAb (ATL-HPA046623)
Datasheet Anti BRMS1L pAb (ATL-HPA046623) Datasheet (External Link)
Vendor Page Anti BRMS1L pAb (ATL-HPA046623)



Citations for Anti BRMS1L pAb (ATL-HPA046623) – 1 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed