Anti BRD3 pAb (ATL-HPA051830)

Atlas Antibodies

SKU:
ATL-HPA051830-25
  • Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nuclear bodies.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: bromodomain containing 3
Gene Name: BRD3
Alternative Gene Name: KIAA0043, ORFX, RING3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026918: 94%, ENSRNOG00000007681: 90%
Entrez Gene ID: 8019
Uniprot ID: Q15059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQTPVIAATPVPTITANVTSV
Gene Sequence MPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQTPVIAATPVPTITANVTSV
Gene ID - Mouse ENSMUSG00000026918
Gene ID - Rat ENSRNOG00000007681
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BRD3 pAb (ATL-HPA051830)
Datasheet Anti BRD3 pAb (ATL-HPA051830) Datasheet (External Link)
Vendor Page Anti BRD3 pAb (ATL-HPA051830) at Atlas Antibodies

Documents & Links for Anti BRD3 pAb (ATL-HPA051830)
Datasheet Anti BRD3 pAb (ATL-HPA051830) Datasheet (External Link)
Vendor Page Anti BRD3 pAb (ATL-HPA051830)