Anti BRCC3 pAb (ATL-HPA048737)

Atlas Antibodies

SKU:
ATL-HPA048737-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BRCA1/BRCA2-containing complex, subunit 3
Gene Name: BRCC3
Alternative Gene Name: BRCC36, C6.1A, CXorf53
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031201: 99%, ENSRNOG00000048061: 97%
Entrez Gene ID: 79184
Uniprot ID: P46736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSEYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLE
Gene Sequence PSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSEYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLE
Gene ID - Mouse ENSMUSG00000031201
Gene ID - Rat ENSRNOG00000048061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BRCC3 pAb (ATL-HPA048737)
Datasheet Anti BRCC3 pAb (ATL-HPA048737) Datasheet (External Link)
Vendor Page Anti BRCC3 pAb (ATL-HPA048737) at Atlas Antibodies

Documents & Links for Anti BRCC3 pAb (ATL-HPA048737)
Datasheet Anti BRCC3 pAb (ATL-HPA048737) Datasheet (External Link)
Vendor Page Anti BRCC3 pAb (ATL-HPA048737)