Anti BPTF pAb (ATL-HPA048289)

Atlas Antibodies

SKU: ATL-HPA048289-25

• 

Protein Description: bromodomain PHD finger transcription factor
Gene Name: BPTF
Alternative Gene Name: FAC1, FALZ, NURF301
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040481: 94%, ENSRNOG00000047296: 90%
Entrez Gene ID: 2186
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ
• Gene Sequence: TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ
• Gene ID - Mouse: ENSMUSG00000040481
• Gene ID - Rat: ENSRNOG00000047296
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.