Anti BPIFB3 pAb (ATL-HPA045741)

Atlas Antibodies

SKU: ATL-HPA045741-25

• 

Protein Description: BPI fold containing family B, member 3
Gene Name: BPIFB3
Alternative Gene Name: C20orf185, dJ726C3.4, LPLUNC3, RYA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068008: 84%, ENSRNOG00000013398: 84%
Entrez Gene ID: 359710
Uniprot ID: P59826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSLGALGSVEFSLATLPLISNQYIELDINPIVKSVAGDIIDFPKSRAPAKVPPKKDHTSQVMVPLYLFNTTFGL
• Gene Sequence: VSLGALGSVEFSLATLPLISNQYIELDINPIVKSVAGDIIDFPKSRAPAKVPPKKDHTSQVMVPLYLFNTTFGL
• Gene ID - Mouse: ENSMUSG00000068008
• Gene ID - Rat: ENSRNOG00000013398
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.