Anti BPIFB2 pAb (ATL-HPA060121 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA060121-25

• 

Protein Description: BPI fold containing family B, member 2
Gene Name: BPIFB2
Alternative Gene Name: BPIL1, C20orf184, dJ726C3.2, LPLUNC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027481: 73%, ENSRNOG00000012197: 73%
Entrez Gene ID: 80341
Uniprot ID: Q8N4F0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEP
• Gene Sequence: FVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEP
• Gene ID - Mouse: ENSMUSG00000027481
• Gene ID - Rat: ENSRNOG00000012197
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.