Anti BPIFB2 pAb (ATL-HPA049491 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA049491-25
  • Immunohistochemistry analysis in human salivary gland and liver tissues using Anti-BPIFB2 antibody. Corresponding BPIFB2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BPI fold containing family B, member 2
Gene Name: BPIFB2
Alternative Gene Name: BPIL1, C20orf184, dJ726C3.2, LPLUNC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027481: 68%, ENSRNOG00000012197: 71%
Entrez Gene ID: 80341
Uniprot ID: Q8N4F0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDAT
Gene Sequence KLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDAT
Gene ID - Mouse ENSMUSG00000027481
Gene ID - Rat ENSRNOG00000012197
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti BPIFB2 pAb (ATL-HPA049491 w/enhanced validation)
Datasheet Anti BPIFB2 pAb (ATL-HPA049491 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BPIFB2 pAb (ATL-HPA049491 w/enhanced validation)