Anti BORCS6 pAb (ATL-HPA045415)
Atlas Antibodies
- SKU:
- ATL-HPA045415-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BORCS6
Alternative Gene Name: C17orf59, FLJ20014
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045176: 98%, ENSRNOG00000006513: 96%
Entrez Gene ID: 54785
Uniprot ID: Q96GS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTPAIPPIDPEVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELE |
| Gene Sequence | PTPAIPPIDPEVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELE |
| Gene ID - Mouse | ENSMUSG00000045176 |
| Gene ID - Rat | ENSRNOG00000006513 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BORCS6 pAb (ATL-HPA045415) | |
| Datasheet | Anti BORCS6 pAb (ATL-HPA045415) Datasheet (External Link) |
| Vendor Page | Anti BORCS6 pAb (ATL-HPA045415) at Atlas Antibodies |
| Documents & Links for Anti BORCS6 pAb (ATL-HPA045415) | |
| Datasheet | Anti BORCS6 pAb (ATL-HPA045415) Datasheet (External Link) |
| Vendor Page | Anti BORCS6 pAb (ATL-HPA045415) |
| Citations for Anti BORCS6 pAb (ATL-HPA045415) – 1 Found |
| Yordanov, Teodor E; Hipolito, Victoria E B; Liebscher, Gudrun; Vogel, Georg F; Stasyk, Taras; Herrmann, Caroline; Geley, Stephan; Teis, David; Botelho, Roberto J; Hess, Michael W; Huber, Lukas A. Biogenesis of lysosome-related organelles complex-1 (BORC) regulates late endosomal/lysosomal size through PIKfyve-dependent phosphatidylinositol-3,5-bisphosphate. Traffic (Copenhagen, Denmark). 2019;20(9):674-696. PubMed |