Anti BORCS6 pAb (ATL-HPA045415)

Atlas Antibodies

Catalog No.: ATL-HPA045415-25

Protein Description: BLOC-1 related complex subunit 6
Gene Name: BORCS6
Alternative Gene Name: C17orf59, FLJ20014
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045176: 98%, ENSRNOG00000006513: 96%
Entrez Gene ID: 54785
Uniprot ID: Q96GS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTPAIPPIDPEVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELE
• Gene Sequence: PTPAIPPIDPEVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELE
• Gene ID - Mouse: ENSMUSG00000045176
• Gene ID - Rat: ENSRNOG00000006513
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BORCS6 pAb (ATL-HPA045415) – 1 Found

Yordanov, Teodor E; Hipolito, Victoria E B; Liebscher, Gudrun; Vogel, Georg F; Stasyk, Taras; Herrmann, Caroline; Geley, Stephan; Teis, David; Botelho, Roberto J; Hess, Michael W; Huber, Lukas A. Biogenesis of lysosome-related organelles complex-1 (BORC) regulates late endosomal/lysosomal size through PIKfyve-dependent phosphatidylinositol-3,5-bisphosphate. Traffic (Copenhagen, Denmark). 2019;20(9):674-696.