Anti BOP1 pAb (ATL-HPA047869)

Atlas Antibodies

SKU:
ATL-HPA047869-25
  • Immunohistochemical staining of human testis shows nuclear positivity in seminiferus ducts.
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: block of proliferation 1
Gene Name: BOP1
Alternative Gene Name: KIAA0124
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022557: 90%, ENSRNOG00000021773: 89%
Entrez Gene ID: 23246
Uniprot ID: Q14137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPDYWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEP
Gene Sequence PLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPDYWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEP
Gene ID - Mouse ENSMUSG00000022557
Gene ID - Rat ENSRNOG00000021773
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BOP1 pAb (ATL-HPA047869)
Datasheet Anti BOP1 pAb (ATL-HPA047869) Datasheet (External Link)
Vendor Page Anti BOP1 pAb (ATL-HPA047869) at Atlas Antibodies

Documents & Links for Anti BOP1 pAb (ATL-HPA047869)
Datasheet Anti BOP1 pAb (ATL-HPA047869) Datasheet (External Link)
Vendor Page Anti BOP1 pAb (ATL-HPA047869)