Anti BOLA2 pAb (ATL-HPA046696)

Atlas Antibodies

SKU: ATL-HPA046696-25

• 
• 

Protein Description: bolA family member 2
Gene Name: BOLA2
Alternative Gene Name: BOLA2A, My016
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047721: 85%, ENSRNOG00000047988: 88%
Entrez Gene ID: 552900
Uniprot ID: Q9H3K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKPLLQRHRLVNACLAEELPHIHAFEQKTLTPDQWARERQK
• Gene Sequence: GKPLLQRHRLVNACLAEELPHIHAFEQKTLTPDQWARERQK
• Gene ID - Mouse: ENSMUSG00000047721
• Gene ID - Rat: ENSRNOG00000047988
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.