Anti BMP2 pAb (ATL-HPA058610)

Atlas Antibodies

SKU: ATL-HPA058610-25

• 
• 

Product Description

Protein Description: bone morphogenetic protein 2
Gene Name: BMP2
Alternative Gene Name: BMP2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027358: 89%, ENSRNOG00000021276: 91%
Entrez Gene ID: 650
Uniprot ID: P12643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRIS
• Gene Sequence: RLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRIS
• Gene ID - Mouse: ENSMUSG00000027358
• Gene ID - Rat: ENSRNOG00000021276
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links