Protein Description: BMI1 proto-oncogene, polycomb ring finger
Gene Name: BMI1
Alternative Gene Name: PCGF4, RNF51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026739: 95%, ENSRNOG00000016585: 95%
Entrez Gene ID: 648
Uniprot ID: P35226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BMI1
Alternative Gene Name: PCGF4, RNF51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026739: 95%, ENSRNOG00000016585: 95%
Entrez Gene ID: 648
Uniprot ID: P35226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG |
Gene Sequence | RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG |
Gene ID - Mouse | ENSMUSG00000026739 |
Gene ID - Rat | ENSRNOG00000016585 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation) | |
Datasheet | Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation) at Atlas |
Documents & Links for Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation) | |
Datasheet | Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation) |
Citations for Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation) – 2 Found |
Kaufhold, Samantha; Garbán, Hermes; Bonavida, Benjamin. Yin Yang 1 is associated with cancer stem cell transcription factors (SOX2, OCT4, BMI1) and clinical implication. Journal Of Experimental & Clinical Cancer Research : Cr. 2016;35( 27225481):84. PubMed |
Koren, Ana; Rijavec, Matija; Sodja, Eva; Kern, Izidor; Sadikov, Aleksander; Kovac, Viljem; Korosec, Peter; Cufer, Tanja. High BMI1 mRNA expression in peripheral whole blood is associated with favorable prognosis in advanced non-small cell lung cancer patients. Oncotarget. 2017;8(15):25384-25394. PubMed |