Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA030472-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1, using Anti-BMI1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: BMI1 proto-oncogene, polycomb ring finger
Gene Name: BMI1
Alternative Gene Name: PCGF4, RNF51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026739: 95%, ENSRNOG00000016585: 95%
Entrez Gene ID: 648
Uniprot ID: P35226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
Gene Sequence RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
Gene ID - Mouse ENSMUSG00000026739
Gene ID - Rat ENSRNOG00000016585
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation)
Datasheet Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation)
Datasheet Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation)



Citations for Anti BMI1 pAb (ATL-HPA030472 w/enhanced validation) – 2 Found
Kaufhold, Samantha; Garbán, Hermes; Bonavida, Benjamin. Yin Yang 1 is associated with cancer stem cell transcription factors (SOX2, OCT4, BMI1) and clinical implication. Journal Of Experimental & Clinical Cancer Research : Cr. 2016;35( 27225481):84.  PubMed
Koren, Ana; Rijavec, Matija; Sodja, Eva; Kern, Izidor; Sadikov, Aleksander; Kovac, Viljem; Korosec, Peter; Cufer, Tanja. High BMI1 mRNA expression in peripheral whole blood is associated with favorable prognosis in advanced non-small cell lung cancer patients. Oncotarget. 2017;8(15):25384-25394.  PubMed