Anti BLOC1S2 pAb (ATL-HPA055010)

Atlas Antibodies

SKU: ATL-HPA055010-25

• 

Protein Description: biogenesis of lysosomal organelles complex-1, subunit 2
Gene Name: BLOC1S2
Alternative Gene Name: BLOS2, FLJ30135, MGC10120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057506: 94%, ENSRNOG00000012684: 100%
Entrez Gene ID: 282991
Uniprot ID: Q6QNY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGLQPYLDQINVIEEQVAALEQAAYKLDAYS
• Gene Sequence: AGLQPYLDQINVIEEQVAALEQAAYKLDAYS
• Gene ID - Mouse: ENSMUSG00000057506
• Gene ID - Rat: ENSRNOG00000012684
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.