Anti BIRC7 pAb (ATL-HPA047850)
Atlas Antibodies
- SKU:
- ATL-HPA047850-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: BIRC7
Alternative Gene Name: KIAP, ML-IAP, mliap, RNF50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038840: 51%, ENSRNOG00000043311: 48%
Entrez Gene ID: 79444
Uniprot ID: Q96CA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE |
Gene Sequence | MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE |
Gene ID - Mouse | ENSMUSG00000038840 |
Gene ID - Rat | ENSRNOG00000043311 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BIRC7 pAb (ATL-HPA047850) | |
Datasheet | Anti BIRC7 pAb (ATL-HPA047850) Datasheet (External Link) |
Vendor Page | Anti BIRC7 pAb (ATL-HPA047850) at Atlas Antibodies |
Documents & Links for Anti BIRC7 pAb (ATL-HPA047850) | |
Datasheet | Anti BIRC7 pAb (ATL-HPA047850) Datasheet (External Link) |
Vendor Page | Anti BIRC7 pAb (ATL-HPA047850) |