Anti BICC1 pAb (ATL-HPA045212 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045212-25
  • Western blot analysis in human cell lines Caco-2 and A-431 using Anti-BICC1 antibody. Corresponding BICC1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: BicC family RNA binding protein 1
Gene Name: BICC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014329: 92%, ENSRNOG00000000614: 94%
Entrez Gene ID: 80114
Uniprot ID: Q9H694
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRA
Gene Sequence NAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRA
Gene ID - Mouse ENSMUSG00000014329
Gene ID - Rat ENSRNOG00000000614
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BICC1 pAb (ATL-HPA045212 w/enhanced validation)
Datasheet Anti BICC1 pAb (ATL-HPA045212 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BICC1 pAb (ATL-HPA045212 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BICC1 pAb (ATL-HPA045212 w/enhanced validation)
Datasheet Anti BICC1 pAb (ATL-HPA045212 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BICC1 pAb (ATL-HPA045212 w/enhanced validation)



Citations for Anti BICC1 pAb (ATL-HPA045212 w/enhanced validation) – 1 Found
Sun, Ruohan; Pan, Yujun; Mu, Long; Ma, Yaguang; Shen, Hong; Long, Yu. Development of a 3 RNA Binding Protein Signature for Predicting Prognosis and Treatment Response for Glioblastoma Multiforme. Frontiers In Genetics. 12( 34733320):768930.  PubMed