Anti BHMT pAb (ATL-HPA058310 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA058310-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: BHMT
Alternative Gene Name: BHMT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069324: 90%, ENSRNOG00000011200: 90%
Entrez Gene ID: 635
Uniprot ID: Q93088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFE |
Gene Sequence | KEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFE |
Gene ID - Mouse | ENSMUSG00000069324 |
Gene ID - Rat | ENSRNOG00000011200 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BHMT pAb (ATL-HPA058310 w/enhanced validation) | |
Datasheet | Anti BHMT pAb (ATL-HPA058310 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BHMT pAb (ATL-HPA058310 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BHMT pAb (ATL-HPA058310 w/enhanced validation) | |
Datasheet | Anti BHMT pAb (ATL-HPA058310 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BHMT pAb (ATL-HPA058310 w/enhanced validation) |