Anti BHLHE41 pAb (ATL-HPA056035)

Atlas Antibodies

Catalog No.:
ATL-HPA056035-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: basic helix-loop-helix family, member e41
Gene Name: BHLHE41
Alternative Gene Name: BHLHB3, bHLHe41, DEC2, SHARP-1, SHARP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030256: 86%, ENSRNOG00000007152: 45%
Entrez Gene ID: 79365
Uniprot ID: Q9C0J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY
Gene Sequence PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY
Gene ID - Mouse ENSMUSG00000030256
Gene ID - Rat ENSRNOG00000007152
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BHLHE41 pAb (ATL-HPA056035)
Datasheet Anti BHLHE41 pAb (ATL-HPA056035) Datasheet (External Link)
Vendor Page Anti BHLHE41 pAb (ATL-HPA056035) at Atlas Antibodies

Documents & Links for Anti BHLHE41 pAb (ATL-HPA056035)
Datasheet Anti BHLHE41 pAb (ATL-HPA056035) Datasheet (External Link)
Vendor Page Anti BHLHE41 pAb (ATL-HPA056035)