Anti BHLHA15 pAb (ATL-HPA047834 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047834-100
  • Immunohistochemistry analysis in human pancreas and skeletal muscle tissues using HPA047834 antibody. Corresponding BHLHA15 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & the Golgi apparatus.
  • Western blot analysis in human cell line RPMI-8226.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: basic helix-loop-helix family, member a15
Gene Name: BHLHA15
Alternative Gene Name: bHLHa15, BHLHB8, MIST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052271: 80%, ENSRNOG00000025164: 80%
Entrez Gene ID: 168620
Uniprot ID: Q7RTS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREG
Gene Sequence AKNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREG
Gene ID - Mouse ENSMUSG00000052271
Gene ID - Rat ENSRNOG00000025164
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti BHLHA15 pAb (ATL-HPA047834 w/enhanced validation)
Datasheet Anti BHLHA15 pAb (ATL-HPA047834 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BHLHA15 pAb (ATL-HPA047834 w/enhanced validation)



Citations for Anti BHLHA15 pAb (ATL-HPA047834 w/enhanced validation) – 1 Found
McCracken, Kyle W; Aihara, Eitaro; Martin, Baptiste; Crawford, Calyn M; Broda, Taylor; Treguier, Julie; Zhang, Xinghao; Shannon, John M; Montrose, Marshall H; Wells, James M. Wnt/β-catenin promotes gastric fundus specification in mice and humans. Nature. 2017;541(7636):182-187.  PubMed