Anti BEST2 pAb (ATL-HPA046229)
Atlas Antibodies
- SKU:
- ATL-HPA046229-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BEST2
Alternative Gene Name: FLJ20132, VMD2L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052819: 65%, ENSRNOG00000003737: 68%
Entrez Gene ID: 54831
Uniprot ID: Q8NFU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RRLSFLLRKNSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMP |
Gene Sequence | RRLSFLLRKNSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMP |
Gene ID - Mouse | ENSMUSG00000052819 |
Gene ID - Rat | ENSRNOG00000003737 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BEST2 pAb (ATL-HPA046229) | |
Datasheet | Anti BEST2 pAb (ATL-HPA046229) Datasheet (External Link) |
Vendor Page | Anti BEST2 pAb (ATL-HPA046229) at Atlas Antibodies |
Documents & Links for Anti BEST2 pAb (ATL-HPA046229) | |
Datasheet | Anti BEST2 pAb (ATL-HPA046229) Datasheet (External Link) |
Vendor Page | Anti BEST2 pAb (ATL-HPA046229) |