Anti BDH1 pAb (ATL-HPA058709)

Atlas Antibodies

SKU:
ATL-HPA058709-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added

Product Description

Protein Description: 3-hydroxybutyrate dehydrogenase, type 1
Gene Name: BDH1
Alternative Gene Name: BDH, SDR9C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046598: 88%, ENSRNOG00000001736: 86%
Entrez Gene ID: 622
Uniprot ID: Q02338
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEK
Gene Sequence DSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEK
Gene ID - Mouse ENSMUSG00000046598
Gene ID - Rat ENSRNOG00000001736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti BDH1 pAb (ATL-HPA058709)
Datasheet Anti BDH1 pAb (ATL-HPA058709) Datasheet (External Link)
Vendor Page Anti BDH1 pAb (ATL-HPA058709) at Atlas Antibodies

Documents & Links for Anti BDH1 pAb (ATL-HPA058709)
Datasheet Anti BDH1 pAb (ATL-HPA058709) Datasheet (External Link)
Vendor Page Anti BDH1 pAb (ATL-HPA058709)