Anti BDH1 pAb (ATL-HPA058709)
Atlas Antibodies
- SKU:
- ATL-HPA058709-25
- Shipping:
- Calculated at Checkout
$303.00
Product Description
Protein Description: 3-hydroxybutyrate dehydrogenase, type 1
Gene Name: BDH1
Alternative Gene Name: BDH, SDR9C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046598: 88%, ENSRNOG00000001736: 86%
Entrez Gene ID: 622
Uniprot ID: Q02338
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BDH1
Alternative Gene Name: BDH, SDR9C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046598: 88%, ENSRNOG00000001736: 86%
Entrez Gene ID: 622
Uniprot ID: Q02338
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEK |
Gene Sequence | DSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEK |
Gene ID - Mouse | ENSMUSG00000046598 |
Gene ID - Rat | ENSRNOG00000001736 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti BDH1 pAb (ATL-HPA058709) | |
Datasheet | Anti BDH1 pAb (ATL-HPA058709) Datasheet (External Link) |
Vendor Page | Anti BDH1 pAb (ATL-HPA058709) at Atlas Antibodies |
Documents & Links for Anti BDH1 pAb (ATL-HPA058709) | |
Datasheet | Anti BDH1 pAb (ATL-HPA058709) Datasheet (External Link) |
Vendor Page | Anti BDH1 pAb (ATL-HPA058709) |