Anti BCO2 pAb (ATL-HPA061542)

Atlas Antibodies

SKU:
ATL-HPA061542-25
  • Immunohistochemical staining of human retina shows strong cytoplasmic positivity in photoreceptor cells and and pigment epithelium.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added

Product Description

Protein Description: beta-carotene oxygenase 2
Gene Name: BCO2
Alternative Gene Name: B-DIOX-II, BCDO2, FLJ34464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032066: 82%, ENSRNOG00000038746: 79%
Entrez Gene ID: 83875
Uniprot ID: Q9BYV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCG
Gene Sequence AKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCG
Gene ID - Mouse ENSMUSG00000032066
Gene ID - Rat ENSRNOG00000038746
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti BCO2 pAb (ATL-HPA061542)
Datasheet Anti BCO2 pAb (ATL-HPA061542) Datasheet (External Link)
Vendor Page Anti BCO2 pAb (ATL-HPA061542) at Atlas Antibodies

Documents & Links for Anti BCO2 pAb (ATL-HPA061542)
Datasheet Anti BCO2 pAb (ATL-HPA061542) Datasheet (External Link)
Vendor Page Anti BCO2 pAb (ATL-HPA061542)