Anti BCO2 pAb (ATL-HPA061542)
Atlas Antibodies
- SKU:
- ATL-HPA061542-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: beta-carotene oxygenase 2
Gene Name: BCO2
Alternative Gene Name: B-DIOX-II, BCDO2, FLJ34464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032066: 82%, ENSRNOG00000038746: 79%
Entrez Gene ID: 83875
Uniprot ID: Q9BYV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BCO2
Alternative Gene Name: B-DIOX-II, BCDO2, FLJ34464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032066: 82%, ENSRNOG00000038746: 79%
Entrez Gene ID: 83875
Uniprot ID: Q9BYV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCG |
Gene Sequence | AKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCG |
Gene ID - Mouse | ENSMUSG00000032066 |
Gene ID - Rat | ENSRNOG00000038746 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti BCO2 pAb (ATL-HPA061542) | |
Datasheet | Anti BCO2 pAb (ATL-HPA061542) Datasheet (External Link) |
Vendor Page | Anti BCO2 pAb (ATL-HPA061542) at Atlas Antibodies |
Documents & Links for Anti BCO2 pAb (ATL-HPA061542) | |
Datasheet | Anti BCO2 pAb (ATL-HPA061542) Datasheet (External Link) |
Vendor Page | Anti BCO2 pAb (ATL-HPA061542) |