Anti BCL9L pAb (ATL-HPA049370 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049370-25

• 
• 
• 

Protein Description: B-cell CLL/lymphoma 9-like
Gene Name: BCL9L
Alternative Gene Name: DLNB11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063382: 98%, ENSRNOG00000012420: 97%
Entrez Gene ID: 283149
Uniprot ID: Q86UU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSMCHPGQMSLLGRTGVPPQQGMVPHGLHQGVMSPPQGLMTQQNFMLMKQRGVGGEVYSQPPHMLSPQGSLMGPPPQQNLMVSHPLRQRSVSLDSQMGYLPAP
• Gene Sequence: MSMCHPGQMSLLGRTGVPPQQGMVPHGLHQGVMSPPQGLMTQQNFMLMKQRGVGGEVYSQPPHMLSPQGSLMGPPPQQNLMVSHPLRQRSVSLDSQMGYLPAP
• Gene ID - Mouse: ENSMUSG00000063382
• Gene ID - Rat: ENSRNOG00000012420
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.