Protein Description: B-cell CLL/lymphoma 6B
Gene Name: BCL6B
Alternative Gene Name: BAZF, ZBTB28, ZNF62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000317: 88%, ENSRNOG00000059956: 93%
Entrez Gene ID: 255877
Uniprot ID: Q8N143
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BCL6B
Alternative Gene Name: BAZF, ZBTB28, ZNF62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000317: 88%, ENSRNOG00000059956: 93%
Entrez Gene ID: 255877
Uniprot ID: Q8N143
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YLQMEHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAP |
| Documents & Links for Anti BCL6B pAb (ATL-HPA075112) | |
| Datasheet | Anti BCL6B pAb (ATL-HPA075112) Datasheet (External Link) |
| Vendor Page | Anti BCL6B pAb (ATL-HPA075112) at Atlas |
| Documents & Links for Anti BCL6B pAb (ATL-HPA075112) | |
| Datasheet | Anti BCL6B pAb (ATL-HPA075112) Datasheet (External Link) |
| Vendor Page | Anti BCL6B pAb (ATL-HPA075112) |