Anti BCL6B pAb (ATL-HPA059147)

Atlas Antibodies

SKU: ATL-HPA059147-25

• 

Protein Description: B-cell CLL/lymphoma 6, member B
Gene Name: BCL6B
Alternative Gene Name: BAZF, ZBTB28, ZNF62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000317: 66%, ENSRNOG00000059956: 61%
Entrez Gene ID: 255877
Uniprot ID: Q8N143
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDED
• Gene Sequence: RLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDED
• Gene ID - Mouse: ENSMUSG00000000317
• Gene ID - Rat: ENSRNOG00000059956
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.