Anti BCL6 pAb (ATL-HPA050645)

Atlas Antibodies

SKU:
ATL-HPA050645-25
  • Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm & the Golgi apparatus.
  • Western blot analysis in human cell line Daudi.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: B-cell CLL/lymphoma 6
Gene Name: BCL6
Alternative Gene Name: BCL5, BCL6A, LAZ3, ZBTB27, ZNF51
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 604
Uniprot ID: P41182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EHVVDTCRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVR
Gene Sequence EHVVDTCRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVR
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BCL6 pAb (ATL-HPA050645)
Datasheet Anti BCL6 pAb (ATL-HPA050645) Datasheet (External Link)
Vendor Page Anti BCL6 pAb (ATL-HPA050645) at Atlas Antibodies

Documents & Links for Anti BCL6 pAb (ATL-HPA050645)
Datasheet Anti BCL6 pAb (ATL-HPA050645) Datasheet (External Link)
Vendor Page Anti BCL6 pAb (ATL-HPA050645)