Anti BCAS1 pAb (ATL-HPA054745 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA054745-25
  • Immunohistochemistry analysis in human prostate and skeletal muscle tissues using HPA054745 antibody. Corresponding BCAS1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
  • Western blot analysis in human cerebral cortex tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: breast carcinoma amplified sequence 1
Gene Name: BCAS1
Alternative Gene Name: AIBC1, NABC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013523: 47%, ENSRNOG00000012906: 49%
Entrez Gene ID: 8537
Uniprot ID: O75363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSKPKDSSFFDKFFKLDKGQEKVPGDSQQEAKRAEHQDKVDEVPGLSGQSDDVPAGKDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQ
Gene Sequence PSKPKDSSFFDKFFKLDKGQEKVPGDSQQEAKRAEHQDKVDEVPGLSGQSDDVPAGKDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQ
Gene ID - Mouse ENSMUSG00000013523
Gene ID - Rat ENSRNOG00000012906
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BCAS1 pAb (ATL-HPA054745 w/enhanced validation)
Datasheet Anti BCAS1 pAb (ATL-HPA054745 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCAS1 pAb (ATL-HPA054745 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BCAS1 pAb (ATL-HPA054745 w/enhanced validation)
Datasheet Anti BCAS1 pAb (ATL-HPA054745 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCAS1 pAb (ATL-HPA054745 w/enhanced validation)