Anti BCAP29 pAb (ATL-HPA049694 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049694-25

• 
• 

Protein Description: B-cell receptor-associated protein 29
Gene Name: BCAP29
Alternative Gene Name: BAP29, DKFZp686M2086
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020650: 77%, ENSRNOG00000007884: 82%
Entrez Gene ID: 55973
Uniprot ID: Q9UHQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKK
• Gene Sequence: KLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKK
• Gene ID - Mouse: ENSMUSG00000020650
• Gene ID - Rat: ENSRNOG00000007884
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.