Anti BBS1 pAb (ATL-HPA058283)
Atlas Antibodies
- SKU:
- ATL-HPA058283-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BBS1
Alternative Gene Name: FLJ23590
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006464: 94%, ENSRNOG00000019832: 94%
Entrez Gene ID: 582
Uniprot ID: Q8NFJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLA |
Gene Sequence | IQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLA |
Gene ID - Mouse | ENSMUSG00000006464 |
Gene ID - Rat | ENSRNOG00000019832 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BBS1 pAb (ATL-HPA058283) | |
Datasheet | Anti BBS1 pAb (ATL-HPA058283) Datasheet (External Link) |
Vendor Page | Anti BBS1 pAb (ATL-HPA058283) at Atlas Antibodies |
Documents & Links for Anti BBS1 pAb (ATL-HPA058283) | |
Datasheet | Anti BBS1 pAb (ATL-HPA058283) Datasheet (External Link) |
Vendor Page | Anti BBS1 pAb (ATL-HPA058283) |