Protein Description: basal body orientation factor 1
Gene Name: BBOF1
Alternative Gene Name: C14orf45, CCDC176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057265: 81%, ENSRNOG00000011376: 81%
Entrez Gene ID: 80127
Uniprot ID: Q8ND07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BBOF1
Alternative Gene Name: C14orf45, CCDC176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057265: 81%, ENSRNOG00000011376: 81%
Entrez Gene ID: 80127
Uniprot ID: Q8ND07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ERAHHEAIVQLNDAGRNVFKENVYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKK |
| Documents & Links for Anti BBOF1 pAb (ATL-HPA075108) | |
| Datasheet | Anti BBOF1 pAb (ATL-HPA075108) Datasheet (External Link) |
| Vendor Page | Anti BBOF1 pAb (ATL-HPA075108) at Atlas |
| Documents & Links for Anti BBOF1 pAb (ATL-HPA075108) | |
| Datasheet | Anti BBOF1 pAb (ATL-HPA075108) Datasheet (External Link) |
| Vendor Page | Anti BBOF1 pAb (ATL-HPA075108) |