Anti BBIP1 pAb (ATL-HPA055206)

Atlas Antibodies

SKU: ATL-HPA055206-25

• 

Protein Description: BBSome interacting protein 1
Gene Name: BBIP1
Alternative Gene Name: bA348N5.3, BBIP10, BBS18, NCRNA00081
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000084957: 83%, ENSRNOG00000047019: 85%
Entrez Gene ID: 92482
Uniprot ID: A8MTZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQ
• Gene Sequence: EVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQ
• Gene ID - Mouse: ENSMUSG00000084957
• Gene ID - Rat: ENSRNOG00000047019
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.