Anti BAZ1B pAb (ATL-HPA067010)

Catalog No:
ATL-HPA067010-25
$401.00
Protein Description: bromodomain adjacent to zinc finger domain, 1B
Gene Name: BAZ1B
Alternative Gene Name: WBSCR10, WBSCR9, WSTF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002748: 86%, ENSRNOG00000001453: 86%
Entrez Gene ID: 9031
Uniprot ID: Q9UIG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence RIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDE

Documents & Links for Anti BAZ1B pAb (ATL-HPA067010)
Datasheet Anti BAZ1B pAb (ATL-HPA067010) Datasheet (External Link)
Vendor Page Anti BAZ1B pAb (ATL-HPA067010) at Atlas

Documents & Links for Anti BAZ1B pAb (ATL-HPA067010)
Datasheet Anti BAZ1B pAb (ATL-HPA067010) Datasheet (External Link)
Vendor Page Anti BAZ1B pAb (ATL-HPA067010)