Protein Description: bromodomain adjacent to zinc finger domain, 1B
Gene Name: BAZ1B
Alternative Gene Name: WBSCR10, WBSCR9, WSTF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002748: 86%, ENSRNOG00000001453: 86%
Entrez Gene ID: 9031
Uniprot ID: Q9UIG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BAZ1B
Alternative Gene Name: WBSCR10, WBSCR9, WSTF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002748: 86%, ENSRNOG00000001453: 86%
Entrez Gene ID: 9031
Uniprot ID: Q9UIG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDE |
| Documents & Links for Anti BAZ1B pAb (ATL-HPA067010) | |
| Datasheet | Anti BAZ1B pAb (ATL-HPA067010) Datasheet (External Link) |
| Vendor Page | Anti BAZ1B pAb (ATL-HPA067010) at Atlas |
| Documents & Links for Anti BAZ1B pAb (ATL-HPA067010) | |
| Datasheet | Anti BAZ1B pAb (ATL-HPA067010) Datasheet (External Link) |
| Vendor Page | Anti BAZ1B pAb (ATL-HPA067010) |