Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053291-25

• 
• 

Protein Description: BCL2-associated athanogene 6
Gene Name: BAG6
Alternative Gene Name: BAT3, D6S52E, G3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024392: 100%, ENSRNOG00000000851: 100%
Entrez Gene ID: 7917
Uniprot ID: P46379
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYS
• Gene Sequence: SDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYS
• Gene ID - Mouse: ENSMUSG00000024392
• Gene ID - Rat: ENSRNOG00000000851
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BAG6 pAb (ATL-HPA053291 w/enhanced validation) – 1 Found

Drury, Josephine A; Parkin, Kirstin L; Coyne, Lucy; Giuliani, Emma; Fazleabas, Asgerally T; Hapangama, Dharani K. The dynamic changes in the number of uterine natural killer cells are specific to the eutopic but not to the ectopic endometrium in women and in a baboon model of endometriosis. Reproductive Biology And Endocrinology : Rb&E. 2018;16(1):67.