Anti B4GALT4 pAb (ATL-HPA046819 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046819-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and B4GALT4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403893).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Gene Name: B4GALT4
Alternative Gene Name: beta4Gal-T4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022793: 78%, ENSRNOG00000003114: 77%
Entrez Gene ID: 8702
Uniprot ID: O60513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPF
Gene Sequence AIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPF
Gene ID - Mouse ENSMUSG00000022793
Gene ID - Rat ENSRNOG00000003114
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti B4GALT4 pAb (ATL-HPA046819 w/enhanced validation)
Datasheet Anti B4GALT4 pAb (ATL-HPA046819 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti B4GALT4 pAb (ATL-HPA046819 w/enhanced validation)