Anti B3GAT3 pAb (ATL-HPA051328)
Atlas Antibodies
- SKU:
- ATL-HPA051328-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: B3GAT3
Alternative Gene Name: GlcAT-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071649: 95%, ENSRNOG00000019804: 94%
Entrez Gene ID: 26229
Uniprot ID: O94766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVY |
Gene Sequence | AASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVY |
Gene ID - Mouse | ENSMUSG00000071649 |
Gene ID - Rat | ENSRNOG00000019804 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti B3GAT3 pAb (ATL-HPA051328) | |
Datasheet | Anti B3GAT3 pAb (ATL-HPA051328) Datasheet (External Link) |
Vendor Page | Anti B3GAT3 pAb (ATL-HPA051328) at Atlas Antibodies |
Documents & Links for Anti B3GAT3 pAb (ATL-HPA051328) | |
Datasheet | Anti B3GAT3 pAb (ATL-HPA051328) Datasheet (External Link) |
Vendor Page | Anti B3GAT3 pAb (ATL-HPA051328) |