Anti B3GAT1 pAb (ATL-HPA074314)

Atlas Antibodies

SKU: ATL-HPA074314-25

• 

Product Description

Protein Description: beta-1,3-glucuronyltransferase 1
Gene Name: B3GAT1
Alternative Gene Name: CD57, GlcAT-P, HNK-1, LEU7, NK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045994: 100%, ENSRNOG00000007142: 100%
Entrez Gene ID: 27087
Uniprot ID: Q9P2W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRN
• Gene Sequence: LVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRN
• Gene ID - Mouse: ENSMUSG00000045994
• Gene ID - Rat: ENSRNOG00000007142
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links