Protein Description: beta-1,3-glucuronyltransferase 1
Gene Name: B3GAT1
Alternative Gene Name: CD57, GlcAT-P, HNK-1, LEU7, NK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045994: 100%, ENSRNOG00000007142: 100%
Entrez Gene ID: 27087
Uniprot ID: Q9P2W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: B3GAT1
Alternative Gene Name: CD57, GlcAT-P, HNK-1, LEU7, NK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045994: 100%, ENSRNOG00000007142: 100%
Entrez Gene ID: 27087
Uniprot ID: Q9P2W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRN |
| Documents & Links for Anti B3GAT1 pAb (ATL-HPA074314) | |
| Datasheet | Anti B3GAT1 pAb (ATL-HPA074314) Datasheet (External Link) |
| Vendor Page | Anti B3GAT1 pAb (ATL-HPA074314) at Atlas |
| Documents & Links for Anti B3GAT1 pAb (ATL-HPA074314) | |
| Datasheet | Anti B3GAT1 pAb (ATL-HPA074314) Datasheet (External Link) |
| Vendor Page | Anti B3GAT1 pAb (ATL-HPA074314) |