Anti B3GALT5 pAb (ATL-HPA054684)

Atlas Antibodies

SKU: ATL-HPA054684-25

• 

Protein Description: UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Name: B3GALT5
Alternative Gene Name: B3GalT-V, B3T5, beta3Gal-T5, GLCT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074892: 68%, ENSRNOG00000030983: 68%
Entrez Gene ID: 10317
Uniprot ID: Q9Y2C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTW
• Gene Sequence: YSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTW
• Gene ID - Mouse: ENSMUSG00000074892
• Gene ID - Rat: ENSRNOG00000030983
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.