Anti B3GALT5 pAb (ATL-HPA054092)
Atlas Antibodies
- SKU:
- ATL-HPA054092-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: B3GALT5
Alternative Gene Name: B3GalT-V, B3T5, beta3Gal-T5, GLCT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074892: 72%, ENSRNOG00000030983: 72%
Entrez Gene ID: 10317
Uniprot ID: Q9Y2C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV |
Gene Sequence | GLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV |
Gene ID - Mouse | ENSMUSG00000074892 |
Gene ID - Rat | ENSRNOG00000030983 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti B3GALT5 pAb (ATL-HPA054092) | |
Datasheet | Anti B3GALT5 pAb (ATL-HPA054092) Datasheet (External Link) |
Vendor Page | Anti B3GALT5 pAb (ATL-HPA054092) at Atlas Antibodies |
Documents & Links for Anti B3GALT5 pAb (ATL-HPA054092) | |
Datasheet | Anti B3GALT5 pAb (ATL-HPA054092) Datasheet (External Link) |
Vendor Page | Anti B3GALT5 pAb (ATL-HPA054092) |